PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC024166.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 248aa    MW: 27829.4 Da    PI: 7.1142
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC024166.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.21.3e-311266155
       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  k+rlrWt+eLH+rFv aveqLGG+++AtPk il++m+ + Lt++h+kSHLQkYR+
  EcC024166.20 12 KERLRWTQELHDRFVAAVEQLGGADRATPKGILKAMDYDRLTIYHIKSHLQKYRM 66
                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.723969IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-301067IPR009057Homeodomain-like
SuperFamilySSF466894.84E-171166IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-251266IPR006447Myb domain, plants
PfamPF002492.6E-81465IPR001005SANT/Myb domain
PfamPF143792.1E-1097143IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGLSRGSHGS GKERLRWTQE LHDRFVAAVE QLGGADRATP KGILKAMDYD RLTIYHIKSH  60
LQKYRMSTLI SEKPPKKFER PSISEIFPNF SATCGAQLKE VIRQAQMNYQ ALLSDQDEVQ  120
KNLRLKIEAQ GRYFQRMMDE HQNVRPLTVG TRPNKPSVPS VSLPSLSEES ESHVKEADSD  180
SEGPEEILTR VPKRPRTSLD CDSSPNICNY SAIVARDADS DPPYDLGDIS FLWNLASCPS  240
PVLVPSSM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191197PKRPRTS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010065660.11e-133PREDICTED: uncharacterized protein LOC104452865
STRINGPOPTR_0006s10190.13e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM168021011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-39G2-like family protein